PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI04G21270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 273aa    MW: 29520 Da    PI: 6.5059
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI04G21270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l d + ++G g+W++++ + g+ R +k+c++rw +yl
  ORUFI04G21270.1 15 KGLWSPEEDQKLRDFILRYGHGCWSAVPVKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding50.64.5e-1669113248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g ++ eE+e   ++++ +G++ W+ Iar+++ gRt++++k++w++yl
  ORUFI04G21270.1  69 GMFSREEEETVMNLHATMGNK-WSQIARHLP-GRTDNEVKNYWNSYL 113
                      56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.91062IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.0E-211065IPR009057Homeodomain-like
SuperFamilySSF466892.31E-2813109IPR009057Homeodomain-like
SMARTSM007175.9E-111464IPR001005SANT/Myb domain
PfamPF002493.5E-131562IPR001005SANT/Myb domain
CDDcd001672.04E-101862No hitNo description
PROSITE profilePS5129424.27363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2566116IPR009057Homeodomain-like
SMARTSM007176.1E-1467115IPR001005SANT/Myb domain
PfamPF002491.9E-1469113IPR001005SANT/Myb domain
CDDcd001674.46E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MGCKACQKPK VHYRKGLWSP EEDQKLRDFI LRYGHGCWSA VPVKAGLQRN GKSCRLRWIN  60
YLRPGLKHGM FSREEEETVM NLHATMGNKW SQIARHLPGR TDNEVKNYWN SYLKKRVEGA  120
EAAARKSAEP ADVVTGSPNR SETGQERVAA DRPASSESSG PVESSSADDL SSLTEPAAGL  180
AAVRPHAPVI PKVMFADWFD MDYGTSLAGT APGLSYQGSS SVQVDGPCGG AVDSLHGLGD  240
GGFCWDFDDA ADHMQGGGGL CDLLSMSEFL GIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-26151187109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1071350.0AK107135.1 Oryza sativa Japonica Group cDNA clone:002-124-C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636234.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K41e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A0E0PBY70.0A0A0E0PBY7_ORYRU; Uncharacterized protein
STRINGORGLA04G0168700.10.0(Oryza glaberrima)
STRINGORGLA10G0151700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.15e-59myb domain protein 18